PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_45277_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 151aa    MW: 17724.8 Da    PI: 10.2391
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_45277_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding544e-174388147
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         rg W + Ed +l+++v+q G+ +W++Ia++++ gR++k+c++rw++ 
  cra_locus_45277_iso_1_len_452_ver_3 43 RGHWRPNEDAKLKELVAQNGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 88
                                         899*****************************.***********996 PP

2Myb_DNA-binding55.91e-1795138146
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                          ++++T++E+e+l+ a+k++G++ W++Ia+ ++ gRt++++k+ w+ 
  cra_locus_45277_iso_1_len_452_ver_3  95 KKAFTEDEEERLLAAHKMYGTK-WALIAKLFP-GRTDNSVKNQWHV 138
                                          679*******************.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9993889IPR017930Myb domain
SMARTSM007179.4E-134291IPR001005SANT/Myb domain
PfamPF002491.8E-164388IPR001005SANT/Myb domain
SuperFamilySSF466891.01E-2743136IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-264496IPR009057Homeodomain-like
CDDcd001674.59E-104687No hitNo description
PROSITE profilePS5129424.8690144IPR017930Myb domain
SMARTSM007172.9E-1594142IPR001005SANT/Myb domain
PfamPF002491.2E-1595137IPR001005SANT/Myb domain
CDDcd001674.68E-1097137No hitNo description
Gene3DG3DSA:1.10.10.604.3E-2197143IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
VMNNNCWAFC SNGTETKWRE TDGKMNDIEV KKRSHGHTKI CGRGHWRPNE DAKLKELVAQ  60
NGPQNWNLIA EKLQGRSGKS CRLRWFNQLD PRINKKAFTE DEEERLLAAH KMYGTKWALI  120
AKLFPGRTDN SVKNQWHVIM SRKQREEENN X
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-31431437107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13034KKRSH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00516DAPTransfer from AT5G17800Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006431175.14e-66hypothetical protein CICLE_v10011967mg
SwissprotQ9FDW11e-33MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A067FZ212e-66A0A067FZ21_CITSI; Uncharacterized protein
TrEMBLA0A0B0P2N29e-67A0A0B0P2N2_G
STRINGPGSC0003DMT4000722582e-65(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16842470